This is a working overview of cyclic heptapeptide, written for readers who want more than a one-paragraph summary but less than a textbook.
Reviewed 2025-08-29. Anything still debated is marked as such rather than presented as settled.
Published pharmacokinetic information is limited and comes mainly from small studies rather than registrational trials. Plasma half-life is usually described as short, on the order of tens of minutes, followed by rapid tissue distribution and clearance of the intact peptide. Metabolites and low concentrations of parent compound have been reported in urine, a detail relevant to anti-doping and forensic testing. Whether repeated exposure changes receptor sensitivity or clearance over time remains an open question. Values differ noticeably between analytical assays, so published numbers should be read as approximate rather than definitive.
Melanotan II is a synthetic cyclic heptapeptide with the sequence Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-NH2, corresponding to a molecular formula of C50H69N15O9 and a monoisotopic mass near 1024 daltons. It was designed as a structural analogue of alpha-melanocyte-stimulating hormone, a peptide hormone produced by cleavage of proopiomelanocortin. A lactam bridge between the aspartate and lysine side chains closes the ring, and the C-terminal amide removes a free carboxyl group. Both modifications increase resistance to enzymatic degradation compared with the linear parent hormone. Four substitutions distinguish it from afamelanotide, the linear analogue studied under the name melanotan I.
Outside regulated medicine, melanotan II circulates through online vendors as a research chemical, often marketed for tanning. Products sold this way vary widely in purity, concentration, and labeling accuracy, and independent testing has documented discrepancies. Published reports describe both pigment effects and adverse reactions, including nausea, flushing, and darkening of existing moles. Long-term safety data are sparse, and no large controlled trial has established a risk profile. Questions about cumulative effects on melanocytes remain unresolved in the literature.
Melanotan II is a synthetic peptide analog modeled on alpha-melanocyte-stimulating hormone, a naturally occurring signaling peptide involved in pigmentation. Its structure is a cyclic heptapeptide containing two non-natural substitutions, norleucine at position four and D-phenylalanine at position seven. These modifications resist enzymatic breakdown and extend the molecule's activity relative to the native hormone. The compound binds melanocortin receptors and is studied mainly as a pharmacological tool rather than a therapeutic product. It has never received approval as a medicine in any major jurisdiction.
| Property | Value | Notes |
|---|---|---|
| Molecular formula | C50H69N15O9 | Cyclic heptapeptide, C-terminally amidated |
| Approximate molecular mass | 1024 Da | Monoisotopic mass of the free peptide |
| Appearance | White to off-white powder | Typically supplied as a lyophilised solid |
| Solubility class | Soluble in water and polar solvents | Also dissolves in neutral aqueous buffer |
| Common synonyms | Melanotan II, MT-II, MT-2 | Described as a melanocortin agonist in early literature |
Melanocytes are the pigment-producing cells of the skin, and they carry melanocortin-1 receptors on their surface. When the receptor is activated, cyclic adenosine monophosphate rises inside the cell and raises the activity of enzymes such as tyrosinase, which increases melanin output. Melanotan-2 binds melanocortin-1 receptors in vitro and in animal models, and this binding is generally described as the basis for the tanning effect. Other receptors account for different effects: melanocortin-4 receptors contribute to appetite and erectile signalling, while melanocortin-3 and melanocortin-5 receptors contribute to energy balance and exocrine function.
Early published reports described melanotan-2 as a tanning agent without sun protection, which means darkening is not the same as protection against ultraviolet radiation. Later studies explored the peptide in erectile dysfunction, hemorrhagic shock, and some skin conditions. No regulator in the United States or Europe has approved it for clinical use. Many products labelled melanotan-2 are sold without approval and their identity and purity are unverified. Its long-term safety in humans remains an open question.
Melanotan-2, also written Melanotan II, is a synthetic cyclic heptapeptide designed as an analogue of alpha-melanocyte-stimulating hormone. Its sequence is Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-NH2, and the lactam bridge between the aspartate and lysine side chains constrains the peptide into a ring. This structural change increases receptor affinity and metabolic stability relative to the native hormone. The compound was created in the 1980s as a research tool for studying pigmentation biology.
==== Levels of severity ==== The use of the body mass index in the diagnosis of eating disorders has been controversial, largely owing to its oversimplification of health and failure to take into account complicating factors such as body composition or the initial bodyweight of the patient prior to the onset of AN. As such, the DSM-5 does not have a strict BMI cutoff for the diagnosis of anorexia nervosa, but it nevertheless uses BMI to establish levels of severity, which it states as follows:
==== Nations ==== Bahrain: Bahrain called for a lasting solution that will prevent Iran from getting nuclear weapons or from doing things that could destabilize the region. France: President Emmanuel Macron said that he remained concerned about the "critical" situation in Lebanon, after Israel continued its strikes and occupation of southern Lebanon after the ceasefire, stating that this "cannot be a long-term solution." France also looked forward to securing shipping through the Strait of Hormuz. Germany: Germany urged Iran to respect the ceasefire and to allow ships to cross the Strait of Hormuz safely and freely. They also urged Iran to take advantage of the opportunity for negotiations. India: The Indian Ministry for External Affairs welcomed the US-Iran ceasefire agreement and called for an early end to the conflict for "unimpeded" trade flow through the Strait of Hormuz. Iraq: The Iraqi oil ministry said on 9 April that no Iraqi ships had crossed the Strait since the ceasefire came into effect. Kuwait: Kuwait's foreign ministry urged Iran and its "proxies, including factions, militias, and armed groups loyal to it" to cease all hostilities against Gulf Arab states. Qatar: Qatar's foreign ministry considered the ceasefire "an initial step toward de-escalation" and hoped Iran would "cease all hostile acts and practices that undermine regional stability." Russia: Russia welcomed the ceasefire and expressed hope that the United States would be able to resume peace negotiations in the Russo-Ukrainian war.
Cava (stylized in all caps as CAVA) is an American Mediterranean fast casual restaurant chain with locations across the United States. Cava is owned by the publicly traded Cava Group, which purchased Zoës Kitchen in August 2018. The combined company is the largest restaurant operator in the Mediterranean category in the U.S. restaurant industry. Cava also produces a line of Mediterranean cava dips, spreads, and dressings that are sold in grocery stores across the US. As of May 2023, all Zoës Kitchen restaurants have been closed or replaced by Cava restaurants.
Descemet's Stripping (Automated) Endothelial Keratoplasty (DSEK/DSAEK) in which the diseased Descemet's membrane is removed and replaced by a healthy donor posterior transplant. The transplant tissue can be prepared by a surgeon's hand or ordered already prepared for surgery. Ocular Systems was the first organization to deliver prepared grafts for surgery in 2005. DSEK/DSAEK uses only a small incision that is either self-sealing or may be closed with a few sutures. The small incision offers several benefits over traditional methods of corneal transplant such as penetrating keratoplasty. Because the procedure is less invasive, DSAEK leaves the eye much stronger and less prone to injury than full-thickness transplants. New medical devices such as the EndoSaver (patent pending) are designed to ease process of inserting endothelial tissue into the cornea. Additionally, DSAEK has a more rapid rate of visual recovery. Vision is typically restored in one to six months rather than one to two years. Descemet Membrane Endothelial Keratoplasty (DMEK) is the most recent EK technique in which an isolated Descemet's membrane is transplanted. The DMEK procedure is a 'like for like' replacement of the diseased part of the cornea with visual rehabilitation to 20/40 or better in 90% of cases and 20/25 or better in 60% of cases within the first three months. Rejection rates are lower (1%) and visual recovery is faster than any other form of corneal transplantation.
Agouti signalling peptide adopts an inhibitor cystine knot motif. Along with the homologous Agouti-related peptide, these are the only known mammalian proteins to adopt this fold. The peptide consists of 131 amino acids. The lethal yellow mutation (Ay) was the first embryonic mutation to be characterized in mice, as homozygous lethal yellow mice (Ay/ Ay) die early in development, due to an error in trophectoderm differentiation. Lethal yellow homozygotes are rare today, while lethal yellow and viable yellow heterozygotes (Ay/a and Avy/a) remain more common. In wild-type mice agouti is only expressed in the skin during hair growth, but these dominant yellow mutations cause it to be expressed in other tissues as well. This ectopic expression of the agouti gene is associated with the yellow obese syndrome, characterized by early onset obesity, hyperinsulinemia and tumorigenesis.
Sources: en.wikipedia.org
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
In jaundice owing to hemolysis (prehepatic, or hemolytic, jaundice), the pathophysiology is that overproduction of bilirubin from the extravascular or intravascular hemolysis overwhelms the capacity of the liver to excrete it. The bilirubin present in the plasma is largely unconjugated in this setting as they haven't been taken up and conjugated by the liver. In this case, total serum bilirubin increases while the ratio of direct bilirubin to indirect bilirubin remains 96 to 4 as up to 96%-99% of bilirubin in the bile are conjugated mentioned above. Although there were some studies that showed an inverse correlation between serum bilirubin level and prevalences of ischemic coronary artery disease, cancer mortality, or colorectal cancer in general population, the potential benefits of the chemopreventive function of bilirubin and their causative relations haven't been proved.
99Tc, half-life 211 ka, is produced at a yield of about 6% per fission; see also the main fission products page. It is also produced (via the short-lived nuclear isomer technetium-99m) as a decay product of molybdenum-99. Technetium is particularly mobile in the environment as it forms negatively charged pertechnetate-ions (TcO−4, resembling the permanganate anion), and it presents the biggest radiological hazard among the long-lived fission products. Despite being a metal, technetium usually does not form positively charged ions, but technetium halides like technetium hexafluoride exist. TcF6 is a nuisance in uranium enrichment as its boiling point (328.4 K (55.3 °C; 131.4 °F)) is very close to that of uranium hexafluoride (329.6 K (56.5 °C; 133.6 °F)). The issue is known to enrichment facilities because spontaneous fission also yields small amounts of technetium (which will be in secular equilibrium with its parent nuclides in natural uranium) but if fluoride volatility is employed for reprocessing, a significant share of the "uranium" separated by fractional distillation will be contaminated with technetium requiring a further purification step. Technetium-99 is suitable for nuclear transmutation by slow neutrons as it has a sufficient thermal neutron cross section and as it has no known stable isotopes. Under neutron irradiation, Tc-99 forms Tc-100 which quickly decays to stable 100Ru a valuable platinum group metal.
Researchers report in a preprint the CRISPR alternative fanzor naturally present in eukaryotes with several potential advantages over CRISPR in genome editing, notably smaller size and higher selectiveness. A separate team further demonstrates in a preprint (14 June) the potential of this class of genome editors. 29 June – Astronomers report using a new technique to detect, for the first time, the release of neutrinos from the galactic plane of the Milky Way galaxy. Hazard research is published: study results suggest high-temperature cooking could cause DNA damage within food (especially meat) which in turn could cause human DNA damage (1 June), a study concludes the Italian Phlegraean Fields could be heading towards a first eruption since 1538 (9 June), a small team of researchers evaluates the credibility of net-zero climate targets as currently low (9 June), an AHA review shows that exposure to contaminant metals contributes to cardiovascular diseases (12 June), a study in the context of the opioid epidemic shows males are substantially (2–3 times greater) more vulnerable to or affected by drug overdose mortality than females (15 June), loss of Y chromosome can drive cancer growth (21 June), a study indicates nearly 40% of U.S.
Sources: en.wikipedia.org
No. It is a synthetic analogue carrying four amino acid changes, a lactam ring and an amidated C-terminus. The natural hormone is a linear thirteen-amino-acid peptide processed from proopiomelanocortin.
Afamelanotide is the linear analogue [Nle4-D-Phe7]-alpha-MSH, sometimes called melanotan I, while melanotan II is cyclic and carries three further substitutions. The two are distinct molecules and are not interchangeable in analytical testing.
Binding to the four melanocortin receptor subtypes is well documented in vitro. The relative contribution of each subtype to whole-body effects in humans is far less certain.
It is a synthetic cyclic peptide designed as an analog of alpha-melanocyte-stimulating hormone. It acts on melanocortin receptors and is best known from research into pigmentation. It is not an approved pharmaceutical product.