This is a working overview of melanocortin receptor, written for readers who want more than a one-paragraph summary but less than a textbook.
Reviewed 2025-12-30. Anything still debated is marked as such rather than presented as settled.
Melanotan-2 has not received marketing authorisation from major regulatory agencies for any therapeutic indication. Several jurisdictions classify it as a prescription-only medicine or a controlled substance when supplied for human use. Because approved products do not exist, material sold online usually sits outside pharmaceutical supply chains and formal quality oversight. Regulators have issued public notices describing the compound as unapproved. Enforcement varies, and the legal position differs between countries, which complicates any single general statement about its status.
Scientific discussion of Melanotan-2 spans pharmacology, dermatology, and public-health literature. Laboratory studies examine its receptor binding and cellular effects, while clinical reports describe outcomes observed after unregulated use. These two bodies of work differ in rigour and intent. Peer-reviewed trials of the compound as a medicine are limited, so much of the available information comes from case reports and surveillance data. Authors frequently note the gap between experimental findings and real-world use.
Melanotan II is a synthetic cyclic heptapeptide with the sequence Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-NH2, corresponding to a molecular formula of C50H69N15O9 and a monoisotopic mass near 1024 daltons. It was designed as a structural analogue of alpha-melanocyte-stimulating hormone, a peptide hormone produced by cleavage of proopiomelanocortin. A lactam bridge between the aspartate and lysine side chains closes the ring, and the C-terminal amide removes a free carboxyl group. Both modifications increase resistance to enzymatic degradation compared with the linear parent hormone. Four substitutions distinguish it from afamelanotide, the linear analogue studied under the name melanotan I.
Receptor-binding studies classify melanotan II as a non-selective melanocortin agonist. It interacts with MC1R, MC3R, MC4R and MC5R, with reported affinities in the low nanomolar range and no strong subtype preference. Activation of MC1R on dermal melanocytes shifts pigment synthesis toward eumelanin, the dark polymer deposited in melanosomes and transferred to keratinocytes. Because the same peptide engages MC4R in the hypothalamus, it also appears in animal work on food intake and erectile response, which is why it is discussed in both pigment and metabolic research. Which receptor populations dominate after systemic exposure in humans is not fully established.
Published pharmacokinetic information is limited and comes mainly from small studies rather than registrational trials. Plasma half-life is usually described as short, on the order of tens of minutes, followed by rapid tissue distribution and clearance of the intact peptide. Metabolites and low concentrations of parent compound have been reported in urine, a detail relevant to anti-doping and forensic testing. Whether repeated exposure changes receptor sensitivity or clearance over time remains an open question. Values differ noticeably between analytical assays, so published numbers should be read as approximate rather than definitive.
| Property | Value | Notes |
|---|---|---|
| Regulatory status | Unapproved for therapeutic use | No marketing authorisation from major agencies |
| Legal classification | Varies by jurisdiction | Prescription-only or controlled in several countries |
| Common synonyms | Melanotan II; MT-II | Also referenced by catalogue codes |
| Typical analytical method | Reverse-phase HPLC | Often paired with mass spectrometry |
| Primary literature focus | Receptor pharmacology | Pigmentation and melanocortin signalling |
Solid peptide kept dry at minus twenty degrees Celsius, shielded from light and moisture, is generally considered stable for extended periods. Solutions are divided into single-use aliquots and held at minus twenty or minus eighty degrees Celsius, because repeated freeze-thaw cycles promote aggregation and loss of material to container surfaces. Hydrolysis of the backbone and oxidation of tryptophan are the principal degradation routes in aqueous solution, and both accelerate at ambient temperature. Hygroscopic uptake after a vial is opened can also shift the actual mass weighed, which affects any concentration calculated from it.
Routine characterisation relies on reversed-phase high-performance liquid chromatography with ultraviolet detection near 214 nanometres, using a C18 column and a water-acetonitrile gradient containing trifluoroacetic acid. Electrospray ionisation mass spectrometry confirms the expected molecular mass and can reveal truncated or oxidised by-products that co-elute poorly. Sequence and stereochemistry require additional work, such as peptide mapping or amino acid analysis, because a chromatographic purity figure alone does not distinguish a diastereomer from the target peptide. Independent testing of research-grade material frequently shows measured content below the stated label, so a certificate of analysis is best read together with the method that produced it.
Melanotan II is a synthetic cyclic heptapeptide that acts as an agonist at melanocortin receptors. It was designed as a structural analogue of alpha-melanocyte-stimulating hormone, the endogenous peptide involved in pigment production. The analogue carries a lactam bridge that constrains the ring and slows enzymatic breakdown relative to the native hormone. In research literature it appears under several abbreviations, and naming conventions are not fully standardized. Published descriptions usually place it within the broader melanocortin agonist family.
Receptor binding at MC1R on melanocytes raises intracellular cyclic AMP and increases expression of tyrosinase and related enzymes. The downstream result is greater synthesis of eumelanin, the dark pigment, without ultraviolet exposure acting as the trigger. The compound is not selective, however, and also engages MC3R, MC4R and MC5R, which are expressed in the central nervous system and elsewhere. That lack of selectivity is the explanation usually offered for effects reported outside pigmentation, including appetite suppression and nausea. Selectivity remains a central theme in comparative studies of related peptides.
Human data remain limited and mostly short-term. Reports describe small trials and observational accounts rather than large controlled studies, so questions about dose-response relationships and long-term effects on melanocytes stay open. Whether repeated exposure alters naevus behaviour is not settled in the published record. Researchers also note that self-administered use outside clinical settings makes actual exposure difficult to quantify. Statements about efficacy and safety should therefore be read as preliminary rather than established.
Identity and purity are usually assessed by reversed-phase high-performance liquid chromatography, which separates the target peptide from truncated or oxidised impurities. Mass spectrometry, most often coupled to liquid chromatography, confirms molecular mass and detects substitutions that chromatography alone may miss. Amino acid analysis and peptide mapping supply additional structural evidence, while nuclear magnetic resonance is reserved for full structural confirmation. Laboratories that examine samples sold online report wide variation in actual content, with some vials containing little or none of the labelled material.
Melanotan-2 appears on the World Anti-Doping Agency prohibited list within the peptide hormone class, and several national regulators treat it as an unapproved prescription substance. Some countries restrict importation or sale for personal use. Because the compound is widely traded as a research chemical, the practical legal picture differs between jurisdictions and shifts over time. Human safety data covering long periods are limited, and whether repeated pigmentation changes carry any lasting risk to melanocytes remains an open question.
Freeze-dried melanotan-2 is normally kept as a desiccated powder at minus twenty degrees Celsius or lower, shielded from light and moisture. Peptides of this size degrade through hydrolysis, oxidation and deamidation, and each pathway accelerates as temperature and water activity rise. Repeated freeze-thaw cycles promote aggregation and loss of material, so aliquoting a stock solution before freezing is standard laboratory practice. Once dissolved, the solution is markedly less stable than the powder. In laboratory work, solutions are generally refrigerated and used within days rather than kept for months.
Melanotan-2 is a synthetic linear peptide built from seven amino acids arranged in a short chain. Its sequence is commonly written as Ac-Nle-Asp-His-D-Phe-Arg-Trp-Lys-NH2, which includes a modified N-terminus and an amidated C-terminus. The molecule belongs to the melanocortin family and acts as a receptor agonist. Structural features such as the D-phenylalanine residue and the Nle substitution are associated with increased stability against enzymatic degradation relative to the natural parent peptide.
The compound emerged from research programs in the 1980s that examined analogues of alpha-melanocyte-stimulating hormone for pigmentation and photoprotection. Investigators modified the native sequence to extend activity duration and potency. A related analogue, afamelanotide, was developed within the same broad line of inquiry and eventually gained approval in certain jurisdictions for a rare light-sensitivity condition. Melanotan-2 itself did not progress through the same regulatory route and has no approved therapeutic indication.
Melanocortin receptors comprise five subtypes with distinct tissue distributions and functions. Melanotan-2 is described in the literature as a non-selective agonist that engages several of these subtypes, including MC1R, MC3R, MC4R, and MC5R. MC1R is the subtype most directly linked to melanin production in skin cells. Because the compound is not subtype-selective, its observed effects in experimental settings are generally attributed to activity across multiple receptor pathways rather than to a single target.
=== Transformation in the environment === The silver nanoparticles that pass through wastewater treatment plants undergo transformations in the environment through changes in aggregation state, oxidation state, precipitation of secondary phases, or sorption of organic species. These transformations can result in the formation of colloidal solutions. Each of these new species potentially have toxic effects which have yet to be fully examined. Most silver nanoparticles in products have an organic shell structure around a core of Ag0. This shell is often created with carboxylic acids functional groups, usually using citrate, leading to stabilization through adsorption or covalent attachment of organic compounds. In seawater, glutathione reacts with citrate to form a thioester via esterification.
In nuclear engineering, fissile material is material that can undergo nuclear fission when struck by a neutron of low energy. A self-sustaining thermal chain reaction can only be achieved with fissile material. The predominant neutron energy in a system may be typified by either slow neutrons (i.e., a thermal system) or fast neutrons. Fissile material can be used to fuel thermal-neutron reactors, fast-neutron reactors and nuclear explosives.
Many physicians operate by the World Professional Association of Transgender Health (WPATH) Standards of Care (SoC) model and require psychotherapy and a letter of recommendation from a psychotherapist in order for a transgender person to obtain hormone therapy. Other physicians operate by an informed consent model and have no requirements for transgender hormone therapy aside from consent. Medications used in transgender hormone therapy are also sold without a prescription on the Internet by unregulated online pharmacies, and some transgender women purchase these medications and treat themselves using a do-it-yourself (DIY) or self-medication approach. One reason that many transgender people turn to DIY hormone therapy is due to long waiting lists of up to years for standard physician-based hormone therapy in some parts of the world such as the United Kingdom, as well as due to the often high costs of seeing a physician and the restrictive criteria that make some ineligible for treatment, or simply medical malpractice by physicians that are not adequately trained. The accessibility of transgender hormone therapy differs throughout the world and throughout individual countries.
Sources: en.wikipedia.org
== Chemistry == Grammotoxin is a 36 amino acid protein toxin, with the sequence Asp-Cys-Val-Arg-Phe-Trp-Gly-Lys-Cys-Ser-Gln-Thr-Ser-Asp-Cys-Cys-Pro-His-Leu-Ala-Cys-Lys-Ser-Lys-Trp-Pro-Arg-Asn-Ile-Cys-Val-Trp-Asp-Gly-Ser-Val (DCVRFWGKCSQTSDCCPHLACKSKWPRNICVWDGSV), and disulfide bridges between Cys2-Cys16, Cys9-Cys21 and Cys15-Cys30. It forms an inhibitor cystine knot motif, common in spider toxins. Its chemical formula is: C177H268N52O50S6 Grammotoxin can be purified from Grammostola spatulata venom by reverse phase high performance liquid chromatography.
Burkett (1984), award-winning correspondent for WABC-TV Matthew Cooper (1984), Time magazine White House correspondent and defendant in the Valerie Plame investigation Tom Watson (1984), journalist, entrepreneur Thomas Vinciguerra (1985), journalist, editor and author Naftali Bendavid (1986), Congress correspondent for The Wall Street Journal Susan Benesch (1986), journalist, free speech advocate Elizabeth Rubin (1987), journalist for The New York Times Magazine, sister of Bloomberg News executive editor James Rubin '82 Aram Roston (1988), investigative journalist Edward Lewine (1989), author and freelance journalist Sam Marchiano (1989), television sportscaster, documentarian and activist, daughter of sportscaster Sal Marchiano David Streitfeld (1989), book reporter for The Washington Post; winner of the 2013 Pulitzer Prize for Explanatory Reporting Caroline Glick (1991), Israeli journalist, editor, writer Warren St. John (1991), journalist for The New York Times and former CEO of Patch Michael J. Socolow (1991), broadcast journalist and professor at the University of Maine Jesse Eisinger (1992), Pulitzer Prize-winning reporter for ProPublica Jean H.
== Fetal vs adult healing in humans == Reparation of tissue in the mammalian fetus is radically different than the healing mechanisms observed in a healthy adult. During early gestation fetal skin wounds have the remarkable ability to heal rapidly and without scar formation. Wound healing itself is a particularly complex process and the mechanisms by which scarring occurs involves inflammation, fibroplasia, the formation of granulation tissue and finally scar maturation. Since the observation of scar free healing was first reported in the early fetus decades ago, research has focused intently on the underlying mechanisms which separate scarless fetal wound repair from normal adult wound healing. Scar free healing has been documented in fetuses across the animal kingdom, including mice, rats, monkeys, pigs, and humans. The ability of fetuses to heal without scarring is wound size dependent and also age-dependent, whereby after a specific gestational age, usually 24 weeks in humans, typical scar formation will occur. While the exact mechanisms of scar free healing in the fetus remain unknown, research has shown that it is thought to be due to the complex interaction of the components of the extracellular matrix (ECM), the inflammatory response, cellular mediators and the expression of specific growth factors.
Panago (originally Panagopoulos) is a privately owned quick service pizza chain with 174 franchised locations in Canada, 151 of which are in British Columbia and Alberta. It is headquartered in Abbotsford, British Columbia, where in 1986 the first three stores opened. In recent years it has attempted to make its food healthier as provincial healthier eating guidelines became more strict. Offerings include multigrain crusts, salads, 33 pizza toppings, and other menu items that have no trans fat, MSG, artificial flavours or artificial colours.
Sources: en.wikipedia.org
Monocryl is a synthetic, absorbable suture manufactured in Cornelia, Georgia, USA, and trademarked by Ethicon. It is composed of poliglecaprone 25, which is a copolymer of glycolide and ε-caprolactone. It comes both dyed (violet) and undyed (clear) and is an absorbable monofilament suture. It is generally used for soft-tissue approximation and ligation. It is used frequently for subcuticular dermis closures of the face. It has less of a tendency to exit through the skin after it breaks down, in contrast to Vicryl. It is contraindicated for use in cardiovascular and neurologic tissues and for usage in ophthalmic and microsurgery. The use of poliglecaprone suture may be inappropriate in patients who are older, malnourished, or debilitated, as well as in patients with conditions that may delay wound healing. Monocryl has a low tissue reactivity, maintains high tensile strength, and has a half-life of 7 to 14 days. At 1 week, its in vivo tensile strength is at 50–60% undyed (60–70% dyed), 20–30% undyed (30–40% dyed) at two weeks, and essentially completely hydrolyzed by 91–119 days. When removed from the package, it has a high degree of "memory", or coil. It is slippery, making it easier to pass than a braided suture. It has a consistency close to nylon suture material. It is rarely used for percutaneous skin closure and is not used in areas of high tension (e.g., fascia).
=== Tertiary structure === GALE structure has been resolved for a number of species, including E. coli and humans. GALE exists as a homodimer in various species. While subunit size varies from 68 amino acids (Enterococcus faecalis) to 564 amino acids (Rhodococcus jostii), a majority of GALE subunits cluster near 330 amino acids in length. Each subunit contains two distinct domains. An N-terminal domain contains a 7-stranded parallel β-pleated sheet flanked by α-helices. Paired Rossmann folds within this domain allow GALE to tightly bind one NAD+ cofactor per subunit. A 6-stranded β-sheet and 5 α-helices comprise GALE's C-terminal domain. C-terminal residues bind UDP, such that the subunit is responsible for correctly positioning UDP-glucose or UDP-galactose for catalysis.
==== First Schleswig War ==== This began the First Schleswig War (1848–51). Against unbelievable odds, Denmark emerged victorious, managing to politically outmaneuver the German alliance by garnering support from the British Empire, the Russian Empire and the Second French Empire while defeating the Germans at the Battles of Bov, the Dybbøl, the Fredericia and Isted. However, under pressure from the Great Powers, led by Tsar Alexander II, who had forced Prussia and Austria out of Denmark, the Danes were not permitted to reintegrate Schleswig into Denmark. Alexander thereby sought to preserve the existing European order, per the principles established by the Concert of Europe. This led to the signing of the 1852 London Protocol, which failed to provide a solution to the issue and merely upheld the status quo.
Sources: en.wikipedia.org
Major regulatory agencies have not approved it for any indication. Some countries permit it only under prescription frameworks, while others classify it as a controlled substance.
Much of the evidence comes from case reports and accounts of unregulated use rather than controlled trials. Differences in product purity and dosing add further variability.
Laboratory work focuses on receptor binding and cellular signalling. Observational reports document outcomes after use, and analytical chemists examine samples to assess content and purity.
No. It is a synthetic analogue carrying four amino acid changes, a lactam ring and an amidated C-terminus. The natural hormone is a linear thirteen-amino-acid peptide processed from proopiomelanocortin.